PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00005481-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 232aa    MW: 25016.2 Da    PI: 8.7159
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00005481-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.41.8e-1499143347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  WALNUT_00005481-RA  99 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 143
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.99792148IPR017930Myb domain
SuperFamilySSF466893.44E-1794149IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-1795146IPR006447Myb domain, plants
SMARTSM007171.8E-1096146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-1198143IPR009057Homeodomain-like
CDDcd001676.91E-1099144No hitNo description
PfamPF002491.2E-1199143IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MSGTCGGDSG AAGEIMLFGV RVVVDAMRKS VSLSNLSQYE LHPQELGSMV NNGINLNNNS  60
KEDVAAAATA AAAGGYASAD DAVPSSRASR DRERKRGVPW TEEEHKLFLL GLQKVGKGDW  120
RGISRNFVKT RTPTQVASHA QKYFLRRSNL NRRRRRTSLF DITTDSVTVT PMEEVLGHHQ  180
DTASQPHPLP PPPPVDTCNF SVFPVTVDPA AVPVPIISPL ENLYLGQGNA AA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1151156RRRRRT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00236DAPTransfer from AT1G74840Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2086681e-66KF208668.1 Arachis hypogaea putative MYB-related protein 14 (MYB14) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209410.11e-82hypothetical protein PRUPE_ppa009283mg
SwissprotQ2V9B07e-63MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLM5WA621e-82M5WA62_PRUPE; Uncharacterized protein
STRINGGLYMA05G01640.17e-68(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.22e-49MYB_related family protein